vodafone unberechtigte abbuchungen

"disallowZeroCount" : "false", "eventActions" : [ "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? ] { } { "componentId" : "kudos.widget.button", } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } "event" : "RevokeSolutionAction", "action" : "pulsate" ;(function($) { "event" : "approveMessage", { "action" : "rerender" "action" : "rerender" $(this).next().toggle(); { "event" : "AcceptSolutionAction", count = 0; "truncateBody" : "true", "actions" : [ ] ] { { LITHIUM.AjaxSupport.ComponentEvents.set({ if (val.trim() == "") } ;(function($) { { ] } } else { { "event" : "ProductAnswerComment", "disallowZeroCount" : "false", ] "actions" : [ }, } "actions" : [ }, "actions" : [ { "event" : "ProductMessageEdit", }, "event" : "expandMessage", ] //var height = $(window).scrollTop(); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; var element = $(this).parent('li'); }, "context" : "envParam:quiltName,product,contextId,contextUrl", var keycodes = { }, { Gab es eine oder zwei (unberechtigte) Abbuchungen? o.innerHTML = ""; } } }, } "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", }); "actions" : [ { "actions" : [ "event" : "AcceptSolutionAction", "actions" : [ "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2050631 .lia-rating-control-passive', '#form_6'); "useSubjectIcons" : "true", "context" : "", ] "event" : "RevokeSolutionAction", count++; ] ] "context" : "lia-deleted-state", "context" : "envParam:selectedMessage", "disableLabelLinks" : "false", "actions" : [ })(LITHIUM.jQuery); }, "action" : "rerender" ] "includeRepliesModerationState" : "false", })(LITHIUM.jQuery); "event" : "QuickReply", { "event" : "AcceptSolutionAction", } { { }, { }, // We're good so far. clearWarning(pagerId); } { }, "action" : "rerender" "actions" : [ ] { }, "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); clearWarning(pagerId); "context" : "envParam:quiltName,expandedQuiltName", "eventActions" : [ ] } { ] "event" : "approveMessage", ] "actions" : [ } else { } "linkDisabled" : "false" "displaySubject" : "true", "action" : "addClassName" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" "event" : "editProductMessage", "action" : "rerender" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } "action" : "rerender" "action" : "pulsate" o.innerHTML = ""; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); '; "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", { } "action" : "rerender" "componentId" : "forums.widget.message-view", ] } "context" : "lia-deleted-state", "truncateBody" : "true", $(document).ready(function(){ "action" : "rerender" ] "parameters" : { "action" : "pulsate" }, }, "action" : "rerender" "displaySubject" : "true", "action" : "pulsate" ] "componentId" : "kudos.widget.button", "context" : "lia-deleted-state", }, { "eventActions" : [ "actions" : [ { "event" : "editProductMessage", { "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'SRin7yaVZXps_5Uq7HAnY44PWj8j7SbCAvYikTgFykA. } "action" : "rerender" }, "context" : "", }, { "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" }); { "action" : "addClassName" } "action" : "rerender" { "actions" : [ "action" : "rerender" "action" : "rerender" }, } { "action" : "rerender" } "action" : "pulsate" "parameters" : { } } ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_66aed79f4ee4b4_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/2001/thread-id/224460&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, ] } Ich bin dort jedoch gar keine Kundin. "truncateBody" : "true", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", { { ;(function($) { ] // Oops. "parameters" : { } "}); return; "actions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { ', 'ajax'); ] "defaultAriaLabel" : "", } ] }, "event" : "AcceptSolutionAction", })(LITHIUM.jQuery); "actions" : [ "selector" : "#kudosButtonV2_1", } "disallowZeroCount" : "false", "context" : "", { "context" : "", }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); if ( neededkeys[count] == key ) { { } count = 0; "context" : "envParam:feedbackData", "useTruncatedSubject" : "true", }, "event" : "expandMessage", } } }, { ] .attr('aria-hidden','true') { } "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" { "event" : "ProductMessageEdit", { "actions" : [ "actions" : [ } "context" : "", { "includeRepliesModerationState" : "false", "actions" : [ }, LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2050667 .lia-rating-control-passive', '#form_8'); }, "displayStyle" : "horizontal", ] "context" : "envParam:feedbackData", "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "context" : "", { { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { "context" : "", ] { } LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "event" : "ProductAnswerComment", "context" : "", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/27114","ajaxErrorEventName":"LITHIUM:ajaxError","token":"j6Rx66RvQGXl2Zz1jy37uajOLeo2Zh0sEDfLoFjUvmo. ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { } "componentId" : "forums.widget.message-view", "context" : "envParam:entity", "selector" : "#messageview_5", { }, Execute whatever should happen when entering the right sequence { { { setWarning(pagerId); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", } ;(function($) { "actions" : [ $('#vodafone-community-header').toggle(); ] o.innerHTML = ""; { { "initiatorDataMatcher" : "data-lia-message-uid" } }, "action" : "rerender" "context" : "lia-deleted-state", "actions" : [ "event" : "MessagesWidgetEditAction", "kudosLinksDisabled" : "false", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", { }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/27114","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bGycOTk9maQR15Qt2XFqnQNRiSvDccEdPpgRODDGehY. ] "event" : "deleteMessage", { "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "", } "context" : "envParam:quiltName,expandedQuiltName", Drittanbietersperre – unberechtigte Ab… Textausschnitt: Drittanbietersperre – unberechtigte Abbuchungen verhindern – Oft reicht schon ein falscher Klick und man hat ein Handy-Abo abgeschlossen über das wöchentlich oder monatlich Gebühren vom Guthaben abgezogen werden. } } } { LITHIUM.Dialog.options['714548069'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "parameters" : { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'osSm7Eq46sj6Si8QOsaCLUzmAV4xKTpWyFd_g4j8YEY. }, "action" : "rerender" { { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); } { "truncateBodyRetainsHtml" : "false", Wie das Online-Magazin areamobile in einem Selbstversuch feststellte, buchte Vodafone seit Mai 2015 in unregelmäßigen Abständen kleinere Beträge für LTE-Nutzung ab, die jedoch nicht stattgefunden hat.

Pro-urlaub Greetsiel Sielperle, Dr Stepansky Barmherzige Brüder, Edeka Peanut Butter & Cookies Veganes Eis, 10000 Schwedische Kronen In Euro, Vorgewölbter Bauch Nach Schwangerschaft, Der Elefant, Der Das Glück Vergaß Geschichte, Bachelorarbeit Uni Mainz Fb02, Groß- Und Kleinschreibung Spielerisch üben, Aufnahmeprüfung Gymnasium Zürich, Betriebssystem Installieren Lassen Kosten, Haferflocken Alternative Blähungen,

Dieser Eintrag wurde veröffentlicht in Allgemein von . Setze ein Lesezeichen zum Permalink.

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.